PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2128s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 238aa    MW: 27117.6 Da    PI: 8.8634
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2128s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1881133456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + ++t+ ql  Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Bostr.2128s0071.1.p  81 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 133
                          45699***********************************************9 PP

2HD-ZIP_I/II116.71.3e-3780170292
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          kk+rl++ q+++LE+sF+ee kL+++rKv+l+reLglqprq+avWFqnrRAR+k+kqlE+ y++L+++yd +++e+++L++ev++Lr+ l
  Bostr.2128s0071.1.p  80 KKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRAIL 169
                          9**************************************************************************************877 PP

          HD-ZIP_I/II  92 k 92 
                          +
  Bostr.2128s0071.1.p 170 R 170
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-1868137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-1973138IPR009057Homeodomain-like
PROSITE profilePS5007116.64975135IPR001356Homeobox domain
SMARTSM003891.7E-1677139IPR001356Homeobox domain
CDDcd000862.82E-1580136No hitNo description
PfamPF000464.4E-1681133IPR001356Homeobox domain
PRINTSPR000314.2E-5106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000314.2E-5115131IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEWSTMSNVE NVRVAFMPPP WPESSSFNSL HSFSFDPYAA GNLYTPPADT QTGPVISVPE  60
PEKIMNAYRY PNNNNNEMIK KKRLTSGQLA SLERSFQEEI KLDSDRKVKL SRELGLQPRQ  120
IAVWFQNRRA RWKAKQLEQL YDSLRQEYDV VSREKQMLHD EVKKLRAILR DQGLFKKPIS  180
AGTIKVSSEE ETAELPSVVV AHPRTENLNT GGNQIYGTDQ YNNPMMVASS GWSSYPC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3520291e-167EU352029.1 Arabidopsis lyrata At5g03790-like protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010490871.11e-160PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR01e-152ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLR0FIS61e-159R0FIS6_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60002491e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-139homeobox 51